PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_03263A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 391aa    MW: 43583.5 Da    PI: 5.2466
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_03263AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.7e-192874148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+W++eEde +++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Oropetium_20150105_03263A 28 KGPWSKEEDETIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 74
                               79******************************.*************97 PP

2Myb_DNA-binding24.75.6e-0880110132
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg 32 
                                + +WT+eE+ +l+++++ +G++ W+   + ++
  Oropetium_20150105_03263A  80 KEAWTQEEEIKLIHGHQTYGNK-WAELTKFLP 110
                                579*******************.**9988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-12739IPR009057Homeodomain-like
PROSITE profilePS5129431.4652378IPR017930Myb domain
SuperFamilySSF466894.4E-2625115IPR009057Homeodomain-like
SMARTSM007171.6E-172776IPR001005SANT/Myb domain
PfamPF002495.8E-182874IPR001005SANT/Myb domain
CDDcd001675.36E-163074No hitNo description
Gene3DG3DSA:1.10.10.601.4E-224072IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-1273111IPR009057Homeodomain-like
PROSITE profilePS500906.87675113IPR017877Myb-like domain
SMARTSM007172.279126IPR001005SANT/Myb domain
PfamPF002492.0E-680111IPR001005SANT/Myb domain
CDDcd001676.36E-582111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MKSADISGPT DVQCLHRWQK VLNPELVKGP WSKEEDETII QMVNKLGPKK WSTIAQALPG  60
RIGKQCRERW HNHLNPGINK EAWTQEEEIK LIHGHQTYGN KWAELTKFLP GSSNIDSSSA  120
MTLQNGEDSG FNVVGEVEDT QLQQVFSQTI DLPHDMNEVP NNSMLADSHT SNELEGQLQY  180
TRTICNDSEN HDRSFVPYAV APDPPISVPH GVSECEHSVD MICDVGISSD IQSEQWQDIS  240
FQPIASASEA VNNFSAPLYP LQTLNGIMYQ NSVTSTPPAL TCSDGVSTTS HINHETSHLS  300
FFHQDLEVRL WSSPPRDGSP DAVLKSAAKS FNSTPSIMKK RQRELLSPTS DIMIKRNLTI  360
EQDPGSLGTS SQRIRRSCIA FWRDSYSEQR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-47101144144MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-47101144144MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004967414.16e-73PREDICTED: myb-related protein 3R-1-like
TrEMBLR7WG845e-74R7WG84_AEGTA; Myb-related protein 3R-1
TrEMBLW5A8V52e-75W5A8V5_WHEAT; Uncharacterized protein
STRINGMLOC_10556.14e-68(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-59myb domain protein 3r-4